Structure of PDB 3x1v Chain H Binding Site BS01

Receptor Information
>3x1v Chain H (length=94) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Ligand information
>3x1v Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3x1v Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
Resolution2.921 Å
Binding residue
(original residue number in PDB)		R33 S36 I39 Y40
Binding residue
(residue number reindexed from 1)		R2 S5 I8 Y9
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0042393 histone binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006337 nucleosome disassembly
GO:0006954 inflammatory response
GO:0031639 plasminogen activation
GO:0035092 sperm DNA condensation
GO:0051276 chromosome organization
GO:0071674 mononuclear cell migration
Cellular Component
GO:0000786 nucleosome
GO:0001674 female germ cell nucleus
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0009986 cell surface

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3x1v, PDBe:3x1v, PDBj:3x1v
PDBsum3x1v
PubMed26188507
UniProtP70696|H2B1A_MOUSE Histone H2B type 1-A (Gene Name=H2bc1)

[Back to BioLiP]