Structure of PDB 3vw3 Chain H Binding Site BS01

Receptor Information
>3vw3 Chain H (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLQQSGTVLARPGASVKMSCKASGYTFTNYWMHWIKQRPGQGLEWIGT
IYPGNSDTTYSQKFKGKAKLTAVTSTSTAYMELSSLTNEDSAVYYCSRRN
YGSSYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTSMVTLGCLVKG
YFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTSTWPSETVTCNV
AHPASSTKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3vw3 Structure of a double-stranded DNA (6-4) photoproduct in complex with the 64M-5 antibody Fab
Resolution2.5 Å
Binding residue
(original residue number in PDB)		W33 H35 T58 R95 Y97 Y100I
Binding residue
(residue number reindexed from 1)		W33 H35 T59 R99 Y101 Y105
Binding affinityPDBbind-CN: Kd=0.22uM
External links