Structure of PDB 3uyr Chain H Binding Site BS01

Receptor Information
>3uyr Chain H (length=215) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKLVESEGGLVQPGSSMKLSCTASGFTFSDYYMAWVRQVPEKGLEWVANI
NYDGSSTYYLDSLKGRFIISRDIAKNILYLQMSSLRCEDTATYYCARLTN
GYLDVWGAGTTVTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFP
ESVTVTWNSGSLSSSVHTFPALLESGLYTMSSSVTVPSSTWPSQTVTCSV
AHPASSTTVDKKLEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3uyr The Peptide-receptive transition state of MHC class I molecules: insight from structure and molecular dynamics.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		Y33 N50 Y53 T58 Y59 L99 T100 N101 G102
Binding residue
(residue number reindexed from 1)		Y32 N49 Y52 T57 Y58 L98 T99 N100 G101
External links