Structure of PDB 3uo1 Chain H Binding Site BS01

Receptor Information
>3uo1 Chain H (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVKLVESEGGLVQPGSSMKLSCTASGFTFSDYYMAWVRQVPEKGLEWVAN
INYDGSSTYYLDSLKGRFIISRDIAKNILYLQMSSLRCEDTATYYCARLT
NGYLDVWGAGTTVTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYF
PESVTVTWNSGSLSSSVHTFPALLESGLYTMSSSVTVPSSTWPSQTVTCS
VAHPASSTTVDKKLEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3uo1 The Peptide-receptive transition state of MHC class I molecules: insight from structure and molecular dynamics.
Resolution1.641 Å
Binding residue
(original residue number in PDB)		Y33 N50 Y53 Y59 L99 T100 N101 G102
Binding residue
(residue number reindexed from 1)		Y33 N50 Y53 Y59 L99 T100 N101 G102
External links