Structure of PDB 3ujj Chain H Binding Site BS01

Receptor Information
>3ujj Chain H (length=230) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVQSGAEVKKPGESLKISCKASGYSFSSYWIAWVRQMPGKGLEWMGF
IYPADSDTRYSPSFQGQGTISADKSISTAYLQWSSLKASDTAMYYCAILG
FWGANRGGGGMDVWGQGTTVIVSSASTKGPSVFPLAPSSKSTSGGTAALG
CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKKVEPKSCDKT
Ligand information
>3ujj Chain P (length=17) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TRKSIRIGPGQAFYATG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ujj Human Anti-V3 HIV-1 Monoclonal Antibodies Encoded by the VH5-51/VL Lambda Genes Define a Conserved Antigenic Structure.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		S31 W33 F50 Y52 D54 D56 R58 R100B G100C G100D
Binding residue
(residue number reindexed from 1)		S31 W33 F50 Y52 D55 D57 R59 R106 G107 G108
External links