Structure of PDB 3uji Chain H Binding Site BS01

Receptor Information
>3uji Chain H (length=218) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSAAEVKKPGEALKISCKGSGYSFSNYWIAWVRQMPGKGLEWMGI
VYPDDSDSSYNSSFQGQITFSADKSISTAYLHWTSLQASDTAMYYCARLG
FEGDYSGSFFDYWGQGTLLIVSSASTKGPSVFPLAPSGGTAALGCLVKDY
FPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI
CNVNHKPSNTKVDKKVEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3uji Human Anti-V3 HIV-1 Monoclonal Antibodies Encoded by the VH5-51/VL Lambda Genes Define a Conserved Antigenic Structure.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		W33 Y52 D54 D56 S58 L95 F97 E98 G99 D100 Y100A S100B G100C
Binding residue
(residue number reindexed from 1)		W33 Y52 D55 D57 S59 L99 F101 E102 G103 D104 Y105 S106 G107
External links