Structure of PDB 3u8o Chain H Binding Site BS01

Receptor Information

>3u8o Chain H (length=251) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFG
E

Ligand information

>3u8o Chain I (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

FPRT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3u8o Rational design and characterization of D-Phe-Pro-D-Arg-derived direct thrombin inhibitors.
Resolution	1.28 Å
Binding residue (original residue number in PDB)	H363 Y367 K372 N415 D519 A520 C521 E522 G523 S525 S546 W547 G548
Binding residue (residue number reindexed from 1)	H43 Y47 K52 N95 D191 A192 C193 E194 G195 S197 S218 W219 G220

Enzymatic activity

Enzyme Commision number

3.4.21.5: thrombin.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0005509	calcium ion binding

	Biological Process
GO:0006508	proteolysis
GO:0007596	blood coagulation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3u8o, PDBe:3u8o, PDBj:3u8o
PDBsum	3u8o
PubMed	22457833
UniProt	P00734\|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]