Structure of PDB 3qsu Chain H Binding Site BS01

Receptor Information
>3qsu Chain H (length=61) Species: 889933 (Staphylococcus aureus subsp. aureus ECT-R 2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLI
YKHAISTYTVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qsu Structural mechanism of Staphylococcus aureus Hfq binding to an RNA A-tract.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
F25 G29 S61 T62
Binding residue
(residue number reindexed from 1)
F20 G24 S56 T57
Binding affinityPDBbind-CN: Kd=19.5nM
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Fri Nov 22 08:45:33 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3qsu', asym_id = 'H', bs = 'BS01', title = 'Structural mechanism of Staphylococcus aureus Hfq binding to an RNA A-tract.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3qsu', asym_id='H', bs='BS01', title='Structural mechanism of Staphylococcus aureus Hfq binding to an RNA A-tract.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003723,0006355', uniprot = '', pdbid = '3qsu', asym_id = 'H'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0006355', uniprot='', pdbid='3qsu', asym_id='H')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>