Structure of PDB 3qnw Chain H Binding Site BS01

Receptor Information
>3qnw Chain H (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTL
VNRKVSQRRVDAIGKKQVPCFASMLTKKLHFFPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qnw Structure of human caspase-6 in complex with Z-VAD-FMK: New peptide binding mode observed for the non-canonical caspase conformation.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		E214 G215 Y216 Y217 S218 V261 K272
Binding residue
(residue number reindexed from 1)		E13 G14 Y15 Y16 S17 V60 K65
Enzymatic activity
Enzyme Commision number 3.4.22.59: caspase-6.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3qnw, PDBe:3qnw, PDBj:3qnw
PDBsum3qnw
PubMed21820899
UniProtP55212|CASP6_HUMAN Caspase-6 (Gene Name=CASP6)

[Back to BioLiP]