Structure of PDB 3p70 Chain H Binding Site BS01

Receptor Information
>3p70 Chain H (length=254) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERIEKISMLEKIYIHPRYNWRENLDRDIA
LMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTAK
GQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGD
SGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVI
DQFG
Ligand information
>3p70 Chain G (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADCGLRPLFEKKSLEDKTERELLESYID
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3p70 Structural basis of thrombin-mediated factor V activation: the Glu666-Glu672 sequence is critical for processing at the heavy chain-B domain junction.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		E371 I372 G373 M374 P376 W377 D476 H479 P480 V481 C482 Y497 K498 G499 R500 N527 M574 K575 R581 W582
Binding residue
(residue number reindexed from 1)		E8 I9 G10 M11 P13 W14 D112 H115 P116 V117 C118 Y133 K134 G135 R136 N160 M207 K208 R214 W215
Enzymatic activity
Catalytic site (original residue number in PDB) H406 D462 E565 G566 D567 S568 G569
Catalytic site (residue number reindexed from 1) H43 D98 E198 G199 D200 S201 G202
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3p70, PDBe:3p70, PDBj:3p70
PDBsum3p70
PubMed21555742
UniProtP00734|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]