Structure of PDB 3o45 Chain H Binding Site BS01

Receptor Information
>3o45 Chain H (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWL
AHIYWDDDKRYNPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCARL
YGFTYGFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVK
GYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETV
TCNVAHPASSTKVDKKIVPR
Ligand information
>3o45 Chain P (length=12) Species: 11259 (Human respiratory syncytial virus A2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KNRGIIKTFSNG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3o45 Structure of a Major Antigenic Site on the Respiratory Syncytial Virus Fusion Glycoprotein in Complex with Neutralizing Antibody 101F.
Resolution2.872 Å
Binding residue
(original residue number in PDB)		Y52 W53 D54 D56 R58 Y96 F98 Y100
Binding residue
(residue number reindexed from 1)		Y54 W55 D56 D58 R60 Y101 F103 Y105
External links