Structure of PDB 3o41 Chain H Binding Site BS01

Receptor Information
>3o41 Chain H (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWL
AHIYWDDDKRYNPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCARL
YGFTYGFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVK
GYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETV
TCNVAHPASSTKVDKKIVPR
Ligand information
>3o41 Chain P (length=10) Species: 208893 (Human respiratory syncytial virus A) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KNRGIIKTFS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3o41 Structure of a Major Antigenic Site on the Respiratory Syncytial Virus Fusion Glycoprotein in Complex with Neutralizing Antibody 101F.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		Y52 W53 D54 D56 Y96 F98 Y100
Binding residue
(residue number reindexed from 1)		Y54 W55 D56 D58 Y101 F103 Y105
External links