Structure of PDB 3moa Chain H Binding Site BS01

Receptor Information
>3moa Chain H (length=236) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWL
AIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHR
RGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPSSKST
SGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV
VTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCD
Ligand information
>3moa Chain P (length=12) Species: 11708 (Human immunodeficiency virus type 1 (ZAIRE 6 ISOLATE)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ELLELDKWASLW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3moa Crystal Structure of a Non-Neutralizing HIV-1 gp41 Envelope Antibody Demonstrates Neutralization Mechanism of gp41 Antibodies
Resolution2.3 Å
Binding residue
(original residue number in PDB)		G33 Y52 D54 D56 R58 R95 P98 A100G R100H V100K
Binding residue
(residue number reindexed from 1)		G33 Y54 D56 D58 R60 R100 P103 A112 R113 V116
External links