Structure of PDB 3mlz Chain H Binding Site BS01

Receptor Information
>3mlz Chain H (length=230) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQESGPGLVKPSETLSLTCTVSGGSISGFHWSWIRQPPGKGLEYIGY
IYYSGSTSYNPSLKSRVSMSVDTSRNQFSLELSSVTAADTAVYYCARDFG
EYHYDGRGFQCEGFDLWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTA
ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS
SSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Ligand information
>3mlz Chain P (length=22) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TRKGIHIGPGRAFYATGQITGD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mlz Conserved structural elements in the V3 crown of HIV-1 gp120.
Resolution2.99 Å
Binding residue
(original residue number in PDB)		G31 F32 Y52 Y53 R94 F96 G97 E98 Y99 Y100A D101
Binding residue
(residue number reindexed from 1)		G31 F32 Y52 Y53 R97 F99 G100 E101 Y102 Y104 D115
External links