Structure of PDB 3mlw Chain H Binding Site BS01

Receptor Information

>3mlw Chain H (length=228) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QVQLVQSGAEVKKAGESLEISCKGSGYTFTDHWIAWVRQVPGKGLEWMGM
IYPGDSDTRYSPSLQGRVTMSADKTLSTAYLQWSRLEASDTAMYYCARLH
YSDRSGSYFNDVFHMWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAA
LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS
SLGTQTYICNVNHKPSNTKVDKKVEPKS

Ligand information

>3mlw Chain P (length=17) Species: 11696 (HIV-1 M:B_MN) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KRKRIHIGPGRAFYTTK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3mlw Conserved structural elements in the V3 crown of HIV-1 gp120.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	D31 W33 Y52 D54 L95 Y100D N100F D100G
Binding residue (residue number reindexed from 1)	D31 W33 Y52 D55 L99 Y108 N110 D111

External links

PDB	RCSB:3mlw, PDBe:3mlw, PDBj:3mlw
PDBsum	3mlw
PubMed	20622876

[Back to BioLiP]