Structure of PDB 3mlr Chain H Binding Site BS01

Receptor Information
>3mlr Chain H (length=226) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGEVKQPGQSLKISCKSSGYNFLDSWIGWVRQIPGKGLEWIGI
IYPDDSDAHYSPSFEGQVTMSVDKSISTAYLQWTTLQASDTGKYFCTRLY
LFEGAQSSNAFDLWGQGTMILVSSGTTKGPSVFPLAPSSKSTSGGTAALG
CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKKVEPKS
Ligand information
>3mlr Chain P (length=14) Species: 11698 (Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TKKGIAIGPGRTLY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mlr Conserved structural elements in the V3 crown of HIV-1 gp120.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
D31 W33 Y52 D54 D56 H58 L95 S100C N100E
Binding residue
(residue number reindexed from 1)
D31 W33 Y52 D55 D57 H59 L99 S107 N109
External links