Structure of PDB 3jb9 Chain H Binding Site BS01

Receptor Information
>3jb9 Chain H (length=76) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIPPINFIFKLLQQHTPVSIWLFEQTDIRLQGQIRGFDEFMNIVLDDAVQ
VDAKNNKRELGRILLKGDNITLIQAI
Ligand information
>3jb9 Chain C (length=105) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgucaaagcacuuugcaaaagcuaacguaucuguuucuugccuuuuacca
gaaacagccguuuguaaggugugcuaauuugacuguauaguuuuuguaau
cuuuu
.<<<<<<<<<<<<<<<<<<...........<<<<<<<<.<.......>.>
>>>>>>>...>>>>>>>>>>>>.....>>>>>>.................
.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jb9 Structure of a yeast spliceosome at 3.6-angstrom resolution
Resolution3.6 Å
Binding residue
(original residue number in PDB)		E32 F48
Binding residue
(residue number reindexed from 1)		E24 F40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000395 mRNA 5'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005685 U1 snRNP
GO:0005686 U2 snRNP
GO:0005687 U4 snRNP
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0032991 protein-containing complex
GO:0034715 pICln-Sm protein complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071004 U2-type prespliceosome
GO:0071011 precatalytic spliceosome
GO:0071014 post-mRNA release spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jb9, PDBe:3jb9, PDBj:3jb9
PDBsum3jb9
PubMed26292707
UniProtQ9USZ3|RUXE_SCHPO Small nuclear ribonucleoprotein E (Gene Name=sme1)

[Back to BioLiP]