Structure of PDB 3jau Chain H Binding Site BS01

Receptor Information
>3jau Chain H (length=117) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYIHWVKQRPEQGLEWIGK
IDPANGNTKYDPKFQDKATITADTSSNTAYLQLSSLTSEDTAVYYCANSN
YWFDFDYWGQGTTLTVS
Ligand information
>3jau Chain A (length=17) Species: 1193974 (Human enterovirus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GYPTFGEHKQEKDLEYG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jau Structural Basis for Recognition of Human Enterovirus 71 by a Bivalent Broadly Neutralizing Monoclonal Antibody
Resolution4.8 Å
Binding residue
(original residue number in PDB)		Y33 K50 D52 N57 N100 Y101 W102 F103
Binding residue
(residue number reindexed from 1)		Y33 K50 D52 N57 N100 Y101 W102 F103
External links