Structure of PDB 3ifp Chain H Binding Site BS01

Receptor Information
>3ifp Chain H (length=222) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTLKESGPGILQPSQTLSLTCSFSGFSLSTNGMGVSWIRQPSGKGLEWLA
HIYWDEDKRYNPSLKSRLTISKDTSNNQVFLKITNVDTADTATYYCARRR
IIYDVEDYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCL
VKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSE
TVTCNVAHPASSTKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ifp Structural correlates of antibodies associated with acute reversal of amyloid beta-related behavioral deficits in a mouse model of Alzheimer disease.
Resolution2.95 Å
Binding residue
(original residue number in PDB)		Y54 D56 D58 R60 I102 I103 D108
Binding residue
(residue number reindexed from 1)		Y53 D55 D57 R59 I101 I102 D107
External links