Structure of PDB 3ifl Chain H Binding Site BS01

Receptor Information

>3ifl Chain H (length=214) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMSVGWIRQPSGLEWLAH
IWWDDDKYYNPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCARRTT
TADYFAYWGQGTTLTVSSAKTTPPSVYPLAPGSASMVTLGCLVKGYFPEP
VTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAH
PASSTKVDKKIVPR

Ligand information

>3ifl Chain P (length=7) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DAEFRHD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3ifl Structural correlates of antibodies associated with acute reversal of amyloid beta-related behavioral deficits in a mouse model of Alzheimer disease.
Resolution	1.5 Å
Binding residue (original residue number in PDB)	H52 W54 D56 D58 Y60 D105
Binding residue (residue number reindexed from 1)	H50 W52 D54 D56 Y58 D103

External links

PDB	RCSB:3ifl, PDBe:3ifl, PDBj:3ifl
PDBsum	3ifl
PubMed	19923222

[Back to BioLiP]