Structure of PDB 3h3p Chain H Binding Site BS01

Receptor Information
>3h3p Chain H (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKRPGSSVTVSCKASGGSFSTYALSWVRQAPGRGLEWMGG
VIPLLTITNYAPRFQGRITITADRSTSTAYLELNSLRPEDTAVYYCAREG
TTGWLGKPIGAFAHWGQGTLVTVSS
Ligand information
>3h3p Chain S (length=18) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DPNWFDITAQLWEFSQEL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3h3p Interactions between lipids and human anti-HIV antibody 4E10 can be reduced without ablating neutralizing activity
Resolution2.7 Å
Binding residue
(original residue number in PDB)		T31 G50 V51 I52 I57 N59 E99 K109 P110
Binding residue
(residue number reindexed from 1)		T31 G50 V51 I52 I57 N59 E99 K107 P108
External links