Structure of PDB 3fn0 Chain H Binding Site BS01

Receptor Information
>3fn0 Chain H (length=221) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLLESGPGLLKPSETLSLTCTVSGGSMINYYWSWIRQPPGERPQWLGH
IIYGGTTKYNPSLESRITISRDISKNQFSLRLNSVTAADTAIYYCARVAI
GVSGFLNYYYYMDVWGSGTAVTVSSASTKGPSVFPLAPSSKGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKKVEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3fn0 A conformational switch in human immunodeficiency virus gp41 revealed by the structures of overlapping epitopes recognized by neutralizing antibodies.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		N31 Y33 H50 I52 G54 K58 G98 Y100E
Binding residue
(residue number reindexed from 1)		N31 Y33 H50 I52 G54 K58 G101 Y108
External links