Structure of PDB 3e8u Chain H Binding Site BS01

Receptor Information
>3e8u Chain H (length=213) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQLVQSGPELRKPGETVKISCKGSGYTFTHYGINWVKQTPSKDLKWMGW
INTHTGEPIYADDFKGRFAFSLETSANTAYLQINNLNNGDMGTYFCTRSH
RFGLDYWGQGTSVTVSSAKTTPPSVYPLAPGSAASMVTLGCLVKGYFPEP
VTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAH
PASSTKVDKKILD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3e8u Crystal structure and thermodynamic analysis of diagnostic mAb 106.3 complexed with BNP 5-13 (C10A).
Resolution2.1 Å
Binding residue
(original residue number in PDB)		T30 H31 Y32 G33 W47 W50 N52 T52A S95 H96 R97
Binding residue
(residue number reindexed from 1)		T30 H31 Y32 G33 W47 W50 N52 T53 S99 H100 R101
External links