Structure of PDB 3dsf Chain H Binding Site BS01

Receptor Information
>3dsf Chain H (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPKGSLKISCAASGFTFNIYAMNWVRQAPGKGLEWVAR
IRSQSNNYTTYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYYCVR
QMGDYWGQGTTLTVSSAVKTPPSVYPLAPGGGAISNSMVTLGCLVNGYFP
EPVTVTWNAGSLGSGVHTFPAVLQSDLYTLSSSVTVPVSTWPSEAVTCNV
AHPASATSVDKAISPV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dsf Molecular basis of recognition of human osteopontin by 23C3, a potential therapeutic antibody for treatment of rheumatoid arthritis
Resolution2.8 Å
Binding residue
(original residue number in PDB)		I31 Y32 A33 R52 S53 N56 Q101
Binding residue
(residue number reindexed from 1)		I31 Y32 A33 R52 S53 N56 Q101
External links