Structure of PDB 3d8a Chain H Binding Site BS01

Receptor Information
>3d8a Chain H (length=63) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFNQTEFNKLLLECVVKTQSSVAKILGIESLSPHVSGNSKFEYANMVEDI
REKVSSEMERFFP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3d8a Structural basis of specific TraD-TraM recognition during F plasmid-mediated bacterial conjugation.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		Y102 V106 R110
Binding residue
(residue number reindexed from 1)		Y43 V47 R51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3d8a, PDBe:3d8a, PDBj:3d8a
PDBsum3d8a
PubMed18717787
UniProtP10026|TRAM1_ECOLI Relaxosome protein TraM (Gene Name=traM)

[Back to BioLiP]