Structure of PDB 3c2a Chain H Binding Site BS01

Receptor Information
>3c2a Chain H (length=231) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVKPGGSLRLTCVASGFTFSDVWLNWVRQAPGKGLEWVGR
IKSRTDGGTTDYAASVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYSCTT
DGFIMIRGVSEDYYYYYMDVWGKGTTVTVSSASTKGPSVFPLAPCSRSTS
GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV
TVPSSSLGTQTYTCNVNHKPSNTKVDKRVEL
Ligand information
>3c2a Chain P (length=13) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSIHLGPGRAFYA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3c2a Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
Resolution2.1 Å
Binding residue
(original residue number in PDB)		W33 R50 D95 D100F Y100G Y100H Y100J
Binding residue
(residue number reindexed from 1)		W33 R50 D101 D112 Y113 Y114 Y116
External links