Structure of PDB 3bky Chain H Binding Site BS01

Receptor Information
>3bky Chain H (length=226) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGA
IYPGNGDTSYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARVV
YYSNSYWYFDVWGTGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCL
VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bky Crystal structure of chimeric antibody C2H7 Fab in complex with a CD20 peptide
Resolution2.61 Å
Binding residue
(original residue number in PDB)		N33 A50 Y52 D57 T58 S59 V99 Y101 W107
Binding residue
(residue number reindexed from 1)		N33 A50 Y52 D57 T58 S59 V99 Y101 W107
External links