Structure of PDB 2y6s Chain H Binding Site BS01

Receptor Information
>2y6s Chain H (length=206) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQQSGPELVKPGASVKMSCKASGYTFTDYVISWVKQRTGQGLEWIGE
FYPGTDSTYYTENFKGRATLTADKSSKTAYMQLSSLTSEDSAVYFCATAF
DYWGQGTTLTVSSAATTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSG
SLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVD
KKIVPR
Ligand information
>2y6s Chain Q (length=15) Species: 128951 (Ebola virus - Zaire (1995)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KLGLITNTIAGVAGL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2y6s Structure of an Ebola Virus-Protective Antibody in Complex with its Mucin-Domain Linear Epitope.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		D31 Y32 V33 E50 Y52 T55 Y59 A99 F100 D101
Binding residue
(residue number reindexed from 1)		D31 Y32 V33 E50 Y52 T55 Y59 A99 F100 D101
External links