Structure of PDB 2y06 Chain H Binding Site BS01

Receptor Information

>2y06 Chain H (length=215) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGR
IDPNSGGTAYNEKFKSKATLTVDKPSSTAYMALSSLTSADSAVYYCARYD
YYGGSYFDYWGQGTTLTVSSGGTTPPSVYPLAPGSSMVTLGCLVKGYFPE
PVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVA
HPASSTAVDKAIVPR

Ligand information

>2y06 Chain P (length=9) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DPRPSYISH

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2y06 Structural Elucidation of the Mechanistic Basis of Degeneracy in the Primary Humoral Response.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	W33 R50 G57 G103
Binding residue (residue number reindexed from 1)	W33 R50 G57 G103

External links

PDB	RCSB:2y06, PDBe:2y06, PDBj:2y06
PDBsum	2y06
PubMed	22266283

[Back to BioLiP]