Structure of PDB 2v17 Chain H Binding Site BS01

Receptor Information
>2v17 Chain H (length=222) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVNLVESGGGLEQSGGSLSLSCAASGFTFTDYYMSWVRQPPGKALEWLAL
IRNKAKGYTTEYSASVKGRFTISRDNSQSILYLQMNALRAEDSAIYYCAR
DNGAARATFAYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTLGCL
VKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQ
TVTCSVAHPASSTTVDKKLEPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2v17 X-Ray Structure of the Phf Core C-Terminus: Insight Into the Folding of the Intrinsically Disordered Protein Tau in Alzheimer'S Disease.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		Y33 R52 A104 A105 R106
Binding residue
(residue number reindexed from 1)		Y33 R52 A104 A105 R106
External links