Structure of PDB 2uud Chain H Binding Site BS01

Receptor Information
>2uud Chain H (length=121) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVKLVESGGGLVQPGGSLRLSCATSGFSFTDYYMAWVRQPPGKALEWLAF
IRNKANGYTTDYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCAR
GDYYGAWFAYWGQGTLVTVSA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2uud Structural Basis of Affinity Maturation of the Tepc15-Vkappa45.1 Anti-2-Phenyl-5-Oxazolone Antibodies
Resolution2.9 Å
Binding residue
(original residue number in PDB)		Q13 A113
Binding residue
(residue number reindexed from 1)		Q13 A121
External links