Structure of PDB 2qhr Chain H Binding Site BS01

Receptor Information
>2qhr Chain H (length=222) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQVVESGGGLVKPGGSLKLSCAASGFAFSSYDMSWVRQTPEKRLEWVAY
ISRGGGYTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCSRHI
YYGSSHYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGC
LVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPS
QSITCNVAHPASSTKVDKKIEP
Ligand information
>2qhr Chain P (length=11) Species: 129000 (Ebola virus - Eckron (Zaire, 1976)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VEQHHRRTDND
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qhr Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		D33 Y50 S52 R52A G53 G55 Y56 Y58 I96 Y98 H100B Y100C Y100D
Binding residue
(residue number reindexed from 1)		D33 Y50 S52 R53 G54 G56 Y57 Y59 I100 Y102 H106 Y107 Y108
External links