Structure of PDB 2pyo Chain H Binding Site BS01

Receptor Information
>2pyo Chain H (length=95) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Ligand information
>2pyo Chain I (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagatactaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctggaatccagctgaacatgccttttgatgga
gcagtttccaaatacacttttggtagtatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pyo Structure of the Drosophila nucleosome core particle highlights evolutionary constraints on the H2A-H2B histone dimer.
Resolution2.43 Å
Binding residue
(original residue number in PDB)		K29 R30 K31 E32 S33 I36
Binding residue
(residue number reindexed from 1)		K2 R3 K4 E5 S6 I9
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0044877 protein-containing complex binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2pyo, PDBe:2pyo, PDBj:2pyo
PDBsum2pyo
PubMed17957772
UniProtP02283|H2B_DROME Histone H2B (Gene Name=His2B)

[Back to BioLiP]