Structure of PDB 2oje Chain H Binding Site BS01

Receptor Information
>2oje Chain H (length=214) Species: 2111 (Metamycoplasma arthritidis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFK
LKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQ
IKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQ
KLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIE
LKTTSDFAKAVFED
Ligand information
>2oje Chain G (length=13) Species: 162497 (Influenza A virus (A/Taiwan/0095/1996(H3N2))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PKYVKQNTLKLAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2oje Zinc induces dimerization of the class II major histocompatibility complex molecule that leads to cooperative binding to a superantigen.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Q12 H14
Binding residue
(residue number reindexed from 1)		Q13 H15
Enzymatic activity
Enzyme Commision number ?
External links