Structure of PDB 2nqb Chain H Binding Site BS01

Receptor Information
>2nqb Chain H (length=93) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRKESYAIYIYTVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Ligand information
>2nqb Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2nqb Comparative analysis of nucleosome structures from different species.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
K1429 K1431 S1433 I1436 Y1437
Binding residue
(residue number reindexed from 1)
K1 K3 S5 I8 Y9
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0044877 protein-containing complex binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2nqb, PDBe:2nqb, PDBj:2nqb
PDBsum2nqb
PubMed
UniProtP02283|H2B_DROME Histone H2B (Gene Name=His2B)

[Back to BioLiP]