Structure of PDB 2mpa Chain H Binding Site BS01

Receptor Information
>2mpa Chain H (length=224) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVNLQQSGTVLARPGASVRMSCKASGYSFTSYWLHWIKQRPGQGLEWIGG
IYPGNRDTRYTQRFKDKAKLTAVTSANTAYMELSSLTNEDSAVYYCSIIY
FDYADFIMDYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLV
KGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQS
ITCNVAHPASSTKVDKKIEPRGPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2mpa Bactericidal antibody recognition of a PorA epitope of Neisseria meningitidis: crystal structure of a Fab fragment in complex with a fluorescein-conjugated peptide.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		S31 Y32 W33 H35 R59 I99 Y100 D102
Binding residue
(residue number reindexed from 1)		S31 Y32 W33 H35 R59 I99 Y100 D102
Enzymatic activity
Enzyme Commision number ?
External links