Structure of PDB 2hrp Chain H Binding Site BS01

Receptor Information
>2hrp Chain H (length=226) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVQLVESGGGLVQPGGSRKLSCAASGFTFMRFGMHWVRQAPEKGLEWVAY
ISSGSSTIYYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTALYYCARSG
GIERYDGTYYVMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTL
GCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPR
PSETVTCNVAHPASSTKVDKKIVPRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hrp Three-dimensional structure of an Fab-peptide complex: structural basis of HIV-1 protease inhibition by a monoclonal antibody.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Y50 Y58 R100 D100B G100C T100D Y100E Y100F
Binding residue
(residue number reindexed from 1)		Y50 Y59 R104 D106 G107 T108 Y109 Y110
External links