Structure of PDB 2hh0 Chain H Binding Site BS01

Receptor Information
>2hh0 Chain H (length=217) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLLEQSGAELVKPGASVKLSCTASGFNIEDSYIHWVKQRPEQGLEWIGR
IDPEDGETKYAPKFQGKATITADTSSNTAYLHLRRLTSEDTAIYYCGRGA
YYIKEDFWGQGTTLTVSSASTKGPSVFPLAPSSKAGGTAALGCLVKDYFP
EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN
VNHKPSNTKVDKKVEPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hh0 Directed evolution of an anti-prion protein scFv fragment to an affinity of 1 pM and its structural interpretation
Resolution2.85 Å
Binding residue
(original residue number in PDB)		E32 Y40 H42 D59 E61 G109 A110 Y111 I134 D137 W139
Binding residue
(residue number reindexed from 1)		E30 Y33 H35 D52 E54 G99 A100 Y101 I103 D106 W108
External links