Structure of PDB 2hfg Chain H Binding Site BS01

Receptor Information
>2hfg Chain H (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPGGSLRLSCAASGFTISSSSIHWVRQAPGKGLEWVAW
VLPSVGFTDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARRV
CYNRLGVCAGGMDYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKD
YFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY
ICNVNHKPSNTKVDKKVEPK
Ligand information
>2hfg Chain R (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
APAPTPCNPAECFDPLVRHCVACGLLR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2hfg Synthetic anti-BR3 antibodies that mimic BAFF binding and target both human and murine B cells.
Resolution2.61 Å
Binding residue
(original residue number in PDB)
S31 W50 L52 R95 C97 Y98 N99 G100B V100C C100D
Binding residue
(residue number reindexed from 1)
S31 W50 L52 R99 C101 Y102 N103 G106 V107 C108
Enzymatic activity
Enzyme Commision number ?
External links