Structure of PDB 2h1p Chain H Binding Site BS01

Receptor Information
>2h1p Chain H (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVKLVESGGGLVKLGGSLKLSCAASGFTFSSYFLSWVRQTPEKRLELVAT
INSNGDKTYHPDTMKGRFTISRDNAKNTLYLQMSSLKSEDTALYYCARRD
SSASLYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVK
GYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETV
TCNVAHPASSTKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2h1p The three-dimensional structures of a polysaccharide binding antibody to Cryptococcus neoformans and its complex with a peptide from a phage display library: implications for the identification of peptide mimotopes.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		F333 K357 R399 A403 L405
Binding residue
(residue number reindexed from 1)		F33 K57 R99 A103 L105
External links