Structure of PDB 2fx9 Chain H Binding Site BS01

Receptor Information
>2fx9 Chain H (length=227) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKRPGSSVTVSCKASGGSFSTYALSWVRQAPGRGLEWMGG
VIPLLTITNYAPRFQGRITITADRSTSTAYLELNSLRPEDTAVYYCAREG
TTGWGWLGKPIGAFAHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTA
ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS
SSLGTQTYICNVNHKPSNTKVDKKVEP
Ligand information
>2fx9 Chain P (length=14) Species: 11705 (Human immunodeficiency virus type 1 (WMJ2 ISOLATE)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NWFCITRWLWKKKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2fx9 Structural basis of enhanced binding of extended and helically constrained peptide epitopes of the broadly neutralizing HIV-1 antibody 4E10.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		T31 A33 G50 V51 I52 I56 N58 E95 G100D K100E P100F
Binding residue
(residue number reindexed from 1)		T31 A33 G50 V51 I52 I57 N59 E99 G108 K109 P110
External links