Structure of PDB 2eh8 Chain H Binding Site BS01

Receptor Information

>2eh8 Chain H (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QVQLVQSGAEVVKPGASVKVSCKASGYAFSSSWMNWVRQAPGQGLEWIGR
IYPGDGDTNYAQKFQGKATLTADKSTSTAYMELSSLRSEDTAVYFCAREY
DEAYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE
PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNV
NHKPSNTKVDKKVEPKSC

Ligand information

>2eh8 Chain P (length=10) Species: 10407 (Hepatitis B virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ANSNNPDWDF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2eh8 Broadly neutralizing anti-hepatitis B virus antibody reveals a complementarity determining region H3 lid-opening mechanism
Resolution	2.6 Å
Binding residue (original residue number in PDB)	W33 R50 E95 Y96
Binding residue (residue number reindexed from 1)	W33 R50 E99 Y100

External links

PDB	RCSB:2eh8, PDBe:2eh8, PDBj:2eh8
PDBsum	2eh8
PubMed	17517649

[Back to BioLiP]