Structure of PDB 2ck3 Chain H Binding Site BS01

Receptor Information
>2ck3 Chain H (length=83) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGA
AKANLEKAQSELLGAADEATRAEIQIRIEANEA
Ligand information
>2ck3 Chain I (length=25) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VAYWRQAGLSYIRYSQICAKAVRDA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ck3 How Azide Inhibits ATP Hydrolysis by the F-Atpases.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		L58 P60 S78 S79 G80 E95 E96 L103 D104 N111 A126 A129 E130 Q132 I133 R134 E136
Binding residue
(residue number reindexed from 1)		L20 P22 S30 S31 G32 E38 E39 L46 D47 N54 A69 A72 E73 Q75 I76 R77 E79
Enzymatic activity
Enzyme Commision number '3.6.1.34
3.6.3.14'
Gene Ontology
Molecular Function
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0015986 proton motive force-driven ATP synthesis
Cellular Component
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ck3, PDBe:2ck3, PDBj:2ck3
PDBsum2ck3
PubMed16728506
UniProtP05630|ATPD_BOVIN ATP synthase subunit delta, mitochondrial (Gene Name=ATP5F1D)

[Back to BioLiP]