Structure of PDB 2ck0 Chain H Binding Site BS01

Receptor Information
>2ck0 Chain H (length=211) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQESGGGLVQPRGSLKLSCAASGFTFNTDAMNWVRQAPGKGLEWVAR
IRSKGFNFATYYADSVRDRFTISRDDSQSMLYLQMNNLKTEDTGIYYCVR
GRDGEAMDYWGQGTTLTVSSAKTTPPSVYPLAPMVTLGCLVKGYFPEPVT
VTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPA
SSTKVDKKIVN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ck0 Structures of Angiotensin II and a Phage-Display Selected Cyclic Peptide in Complex with Fab131: Making Angiotensin II Analogs
Resolution2.2 Å
Binding residue
(original residue number in PDB)		R50 R52 G52C F53 N54 Y58
Binding residue
(residue number reindexed from 1)		R50 R52 G55 F56 N57 Y61
External links