Structure of PDB 2brr Chain H Binding Site BS01

Receptor Information
>2brr Chain H (length=224) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLEQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWI
NTYTGEPTYADDFKERFAFSLETSASAAYLQINNLKNEDTATYFCARDYY
GSTYPYYAMDYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCL
VKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQ
SITCNVAHPASSTKVDKKIEPRGG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2brr Crystal Structure of an Anti-Meningococcal Subtype P1.4 Pora Antibody Provides Basis for Peptide- Vaccine Design.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		T30 N31 G33 W50 N52 T52A Y53 D95 Y97 T100 Y100A P100B
Binding residue
(residue number reindexed from 1)		T29 N30 G32 W49 N51 T52 Y53 D98 Y100 T103 Y104 P105
External links