Structure of PDB 2bi6 Chain H Binding Site BS01

Receptor Information

>2bi6 Chain H (length=41) Species: 4615 (Ananas comosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EEYKCYCTDTYSDCPGFCKTCKAEFGKYICLDLISPNDCVK

Ligand information

>2bi6 Chain L (length=11) Species: 4615 (Ananas comosus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TACSECVCPLR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2bi6 Solution structure of bromelain inhibitor IV from pineapple stem: structural similarity with Bowman-Birk trypsin/chymotrypsin inhibitor from soybean.
Resolution	N/A
Binding residue (original residue number in PDB)	E1 E2 Y3 C5 Y6 C7 T8 D9 Y11 C39 V40
Binding residue (residue number reindexed from 1)	E1 E2 Y3 C5 Y6 C7 T8 D9 Y11 C39 V40

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004867	serine-type endopeptidase inhibitor activity

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:2bi6, PDBe:2bi6, PDBj:2bi6
PDBsum	2bi6
PubMed	8611527
UniProt	P01068\|IBRO_ANACO Bromelain inhibitor

[Back to BioLiP]