Structure of PDB 2a6k Chain H Binding Site BS01

Receptor Information

>2a6k Chain H (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGINWVKQRPGQGLEWIGY
INPGNGYTKYNEKFKGKTTLTVDKSSSTAYMQLRSLTSEDSAVYFCARSV
YYGGSYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPE
PVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVA
HPASSTKVDKKIVPRD

Ligand information

>2a6k Chain P (length=10) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GDNLTNHNLR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2a6k Differential epitope positioning within the germline antibody paratope enhances promiscuity in the primary immune response.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	Y50 N52 Y57 K59 Y101 Y106
Binding residue (residue number reindexed from 1)	Y50 N52 Y57 K59 Y101 Y106

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:2a6k, PDBe:2a6k, PDBj:2a6k
PDBsum	2a6k
PubMed	16618601
UniProt	Q6PF95

[Back to BioLiP]