Structure of PDB 1zgl Chain H Binding Site BS01

Receptor Information

>1zgl Chain H (length=168) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GDTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAV
TELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVT
VYPANLLVCSVNGFYPGSIEVRWFVVSTGLIQNGDWTFQTLVMLESGEVY
TCQVEHPSVTSPLTVEWR

Ligand information

>1zgl Chain I (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HFFKNIVTPRTPG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1zgl Structure of a human autoimmune TCR bound to a myelin basic protein self-peptide and a multiple sclerosis-associated MHC class II molecule.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	Y13 D57 Y60 R71 Y78 H81 N82
Binding residue (residue number reindexed from 1)	Y13 D57 Y60 R71 Y78 H81 N82

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1zgl, PDBe:1zgl, PDBj:1zgl
PDBsum	1zgl
PubMed	16079912
UniProt	Q30154\|DRB5_HUMAN HLA class II histocompatibility antigen, DR beta 5 chain (Gene Name=HLA-DRB5)

[Back to BioLiP]