Structure of PDB 1zea Chain H Binding Site BS01

Receptor Information
>1zea Chain H (length=209) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQLVQSGPELKTPGETVRISCKASGYTFTTYGMSWVKQTPGKGFKWMGW
INTYSGVPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARRS
WYFDVWGTGTTVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTW
NSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASST
KVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1zea Structure of an anti-cholera toxin antibody Fab in complex with an epitope-derived D-peptide: a case of polyspecific recognition.
Resolution1.78 Å
Binding residue
(original residue number in PDB)
Y32 G33 W50 N52 T52A R95 S96 W100A
Binding residue
(residue number reindexed from 1)
Y32 G33 W50 N52 T53 R99 S100 W101
Enzymatic activity
Enzyme Commision number ?
External links