Structure of PDB 1uvu Chain H Binding Site BS01

Receptor Information
>1uvu Chain H (length=244) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDI
ALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETVQP
SVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGG
PFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKWKVI
Ligand information
>1uvu Chain L (length=24) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CGLRPLFEKKQVQDQTEKELFESY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1uvu Enzyme flexibility, solvent and 'weak' interactions characterize thrombin-ligand interactions: implications for drug design.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Q20 E23 V24 G25 L26 P28 W29 D116 H119 P120 C122 L129C F134 K135 R137 N159 K202 N205 R206 W207
Binding residue
(residue number reindexed from 1)		Q5 E8 V9 G10 L11 P13 W14 D113 H116 P117 C119 L129 F134 K135 R137 N157 K205 N210 R211 W212
Enzymatic activity
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1uvu, PDBe:1uvu, PDBj:1uvu
PDBsum1uvu
PubMed8939759
UniProtP00735|THRB_BOVIN Prothrombin (Gene Name=F2)

[Back to BioLiP]